Monday, April 29, 2013

Gladiator Games, May 4th, Louisiana!


The May 4th Gladiators Games will be held at the Comeaux Recreation Center in Lafayette, Louisiana!  This will be a great tournament, a very close friend of mine (Josh Artigue) and Tim Credeur and their school, Gladiators Academy, will be running the deal.  Should be a really good opportunity especially because it is not single-elimination, AND it's a classy, safe rule-set unlike lots of local tournaments where it seems any ol' heelhook, neck-crank or spinal lock is okay!



This is located at 411 West Bluebird Drive, Lafayette, LA 70508.

Weigh-ins will be held prior to competition of your individual division. The venue will open at 8:00AM and walk-up registration will be allowed until 9:00AM. Failure to make weight will result in disqualification.

Children's and Masters Divisions will begin at 10:00 AM and adults will begin at noon.

The competition will hold both gi and no-gi divisions following the IBJJF rules. Visit http://www.ibjjf.org/docs/rulesibjjf1stedition.pdf for all the information on rules.

The competition format will use modified double elimination rules for division with 5 or more competitors. Divisions with 1-4 competitors will use a round robin format.

Absolute divisions will be offered but only competitors who have placed in their individual weight divisions will be allowed to enter.

http://www.gladiatorgamestournaments.com

Where have I been?

Sorry for the silence... I was working from home and being occupied with various projects, etc.  But I'm back now :)

Big shout-out to all the great people at the NY Open, especially Mike D, Charlie Liu and the guys at Matt Serra's, Ryan and Jen, Paul, Marcelo and Tati, Emily, Andrew, Shakia, Annie, Danielle, the Rock, the Crusher, Addy of the Green Gi, Chica at Killer Bees in Queens...

Here's a pic sent to me by Danielle, repping the "Female of the Species"--



Not a big shout-out to the people competing under the Team Lloyd Irvin affiliation (not the main academy which was totally absent-- but from some Virginia Beach academy called "Outfox MMA.")

Anyway, had the embryo transfer and now just waiting for to find out if it/they "took" or not.  Fortunately I was permitted to work from home, and now I am cleared by the doctor to resume my usual workouts and physical activity, even including training without knee on belly, no high impact activities, and no working out so hard that I can't speak.  And anyone who knows me knows I am pretty much always talking, so that's not going to happen.

Mitch and I celebrated our fifth anniversary-- we went out to dinner with our favorite cousins ever, Kathy and Joey.



I'm feeling great physically (though I gained 5 lbs from eating lots of fabulous food and not training for a few days, but it's going away quick!) and very excited by the opportunities-- not just for motherhood, which is duh of course, but also the restrictions to rolling "light" which my training partners are being super cool about, and which have made me more open-minded to trying different approaches.  I'm really playing a lot more open guard and trying to sort through the physics of base and connection, while applying some of the big picture lessons from Ryan Hall (muchas gracias) and Andris Brunovskis (formerly of TLI, visiting instructor with us for another couple days..)

Here's a match between Gianni Grippo, before he switched from Renzo's to Marcelo's, and Andris while he was still TLI, last year at the Houston Open.



And here's Andris v. Christopher Broadnax, in 2011.  Ironically Hillary reffed both matches.



Enjoy!

Wednesday, April 17, 2013

Bizarre, gluten-free pizza really is good...

Don't laugh, it's a cauliflower crust.  (Uses cauli instead of flour.  Cray.)

From http://www.mimosasnthemorning.com/2012/07/cauliflower-pizza.html

Recipe:

Ingredients:
1 cup cooked, riced cauliflower
1 cup shredded cheese (I used half mozarella and half parmesean)
1 egg, beaten
1 tsp dried oregano
1/2 tsp crushed garlic
1/2 tsp garlic salt
olive oil (optional)
pizza sauce, shredded cheese and your choice of toppings*
Directions:
To "Rice" the Cauliflower:
Take 1 large head of fresh cauliflower, remove stems and leaves, and chop the florets into chunks. Add to food processor and pulse until it looks like grain. Do not over-do pulse or you will puree it. (If you don't have a food processor, you can grate the whole head with a cheese grater - this is what I did). Place the riced cauliflower into a microwave safe bowl and microwave for 8 minutes (some microwaves are more powerful than others, so you may need to reduce this cooking time). There is no need to add water, as the natural moisture in the cauliflower is enough to cook itself.
One large head should produce approximately 3 cups of riced cauliflower. The remainder can be used to make additional pizza crusts immediately, or can be stored in the refrigerator for up to one week.
To Make the Pizza Crust:
Preheat oven to 450 degrees. Spray a cookie sheet with non-stick cooking spray.
In a medium bowl, stir together 1 cup cauliflower, egg and mozzarella. Add oregano, crushed garlic and garlic salt, stir. Transfer to the cookie sheet, and using your hands, pat out into a 9" round. Optional: Brush olive oil over top of mixture to help with browning.
Bake at 450 degrees for 15 minutes.
Remove from oven. To the crust, add sauce, toppings and cheese. Place under a broiler at high heat just until cheese is melted (approximately 3-4 minutes).
Enjoy!
Note that toppings need to be precooked since you are only broiling for a few minutes.
*And because I'm incapable of following a recipe true to form, here are my changes. First, mini pizzas are a much better option than one large pizza. Not only are they cute, but if you are two people trying to consume an entire pizza, it can get overwhelming. The next biggest being that I used a half&half mixture of fat free mozzarella and fat free shredded parmesan for the required cheese. I find that too much mozzarella can make homemade pizza bland and using this mixture alleviated that problem. The recipe also says you can use your own discretion for the toppings, so I decided to go with fresh basil, mushrooms, and tomatoes.

Monday, April 15, 2013

Lloyd Irvin Exposed joins the ranks..

http://lloydirvinexposed.blogspot.com/ has joined the forces seeking to expose Lloyd Irvin's past to anyone who cares to do the research, mainly looking to keep the information afloat in the top of the SEO game for the long run.  I encourage you to share this link.

Had a great weekend.  Trained a bunch, sucked a bunch, but had tiny glimmers of success here and there.  What more can I ask for?


Thursday, April 11, 2013

Taking action against Lloyd Irvin and Emory Marketing on MMA Millionaires or Mastermind fraud claims.

From a friend who will remain anonymous:

"First of all, I think it’s important to note that there’s a whole lot of misinformation out there regarding what happened during MMA Millionaires seminars, private meetings, and phone calls. Some of it is true, some of it isn’t, but the MMA Millionaires “experience” was fairly straight-forward most of the time… a combination of information and sales pitches. You can argue whether certain lines of ethics were crossed, but it’s hardly an elaborate con. That stated, it does not mean there wasn’t some real shady stuff going on nor that Lloyd Irvin is a super classy guy.

Because of this, I sat down with a very experienced consumer protection attorney for a couple hours to discuss actual facts and any possible recourse. His opinion might differ from other professionals in this field, but keep in mind he has experience with similar cases.

So are there grounds for lawsuits (individual and class action)? The answer is yes and no. It really depends on your circumstance- namely whether there were any damages incurred.

For those who purchased DVDs and never received them or received defective goods, there is recourse. Talk to an attorney if you have requested reimbursement and haven’t received it.

People who attended seminars where 20% of the advertised topics were never covered really have no claim, especially if you found value in other material presented.

For Mastermind members who feel like they were roped into paying for over-priced services or felt like they were stuck paying for a service which they no longer wanted, the answer is maybe.

The agreements used to enroll you into any level of the Mastermind group are not legally binding. You should be able to cancel if you wish to cease payment. So if you want out, simply request cancellation- I’ve personally heard from several former Masterminders that cancellation process was relatively hassle-free. If you paid fully in advance, you are entitled to a partial refund. If they don’t release you from an obligation (monthly or paid in full), then talk to a lawyer.



(random image just to break up blocks of text)

If your business improved financially during your membership (and nearly all members feel this way), you do not have much of a chance of getting any money back. Paying too much for something when you are making more money doesn’t do much in civil court regardless of what promised services were or weren’t delivered. Now, if your business went broke during this time, then you should go talk to a lawyer – but even then Emery Marketing’s exposure is limited. Also keep in mind cases can take anywhere from 1-5 years to be resolved so be aware that Lloyd Irvin is going to be a part of your world for awhile.

None of this means Mastermind members have no legal recourse and there’s nothing to be done by the BJJ/MMA community at large. To paraphrase advice that was given to the Mastermind members whenever a certain classification of business tactics was discussed, “I’m not telling you should do any of this, but someone who wanted to take care of a situation might want to consider it (wink wink)”.

1) Dissatisfied customers can and should file complaints with the Federal Trade Commission, Better Business Bureau, review sites, and other businesses that have relationships with Emery Marketing Systems such as James Malinchak, Jack Canfield, JW Dicks, Nick Nanton, Andrea Adams-Miller, GKIC, and Thad Winston. For this last group- let them know about sites like LloydIrvinRapeTruth.com and the articles on BloodyElbow.com.

In the case of the FTC, they will proceed with investigations into unethical business practices if they receive enough complaints. But people need to actually follow through in large numbers and stick to facts of questionable practices, not emotion. They get overwhelmed with complaints and really only have time to pursue the more egregious offenders.

Make your report via:
www.ftccomplaintassistant.gov/

And use the following business info to make sure the staff realizes all of these complaints are about the same business:

Emory Marketing Systems
6333 Old Branch Avenue Suite 302
Camp Springs, Maryland 20748
United States (301) 449-5425

2) Request to have any testimonial (written or recorded) to be removed immediately from any marketing materials or websites. In many cases, Emory Marketing made no attempt to gather a specific written release of permission so there is virtually no true ownership of the materials regardless of any other paperwork you may have signed. Send a letter or email to get started, if they do not oblige (as required by US copyright law), then you do have legal recourse.

3) Report examples of Emory Marketing’s unauthorized use of third party materials such as music by major recording artists or images taken from MMA events such as the UFC. Lloyd has cooled off on this in recent years but he’ll still use images in web banners, sites, and videos that he likely hasn’t paid for.

A great contact is Lewis and Roca (lawyers for UFC/Zuffa) via http://www.lrlaw.com.  They love suing over any perceived copyright infringement and have been known to even sue MMA fans over even minor issues just to prove a point.

4) Lloyd Irvin has acknowledged using “black hat” SEO tactics in Mastermind meetings on his schools' sites and other businesses he’s involved in. Find as many of these sites as you can, review for anything questionable and then any obvious candidates should be reported to Google and Bing. The sites will be de-listed, PPC campaigns rejected, and lots more stuff that’s destructive to a person who makes their living from interment marketing.
http://support.google.com/adsense/bin/answer.py?hl=en&answer=106431

5) Report Lloyd Irvin and Emory Marketing on internet marketing forums. WarriorForum.com is the big one. As shady as the IM world is, they have standards and blackball people regularly.

As Lloyd teaches at his seminars, none of this knowledge means anything without ACTION. Of course, you also need to consider how deep down the rabbit hole you want to go. Remember that if you spend too much time focusing on the negative, it has a way of consuming your life."

More Lloyd Irvin Maryland BJJ system-gaming...

I see that Lloyd is promoting the URL "maryland-bjj" (instead of lloydirvin.com) on google ads and on facebook ads.

Thanks to some friends who remain anonymous, here's another listing of sites Lloyd Irvin has:


http://bjjmadeeasy.*com/
http://blueprintpaymentplans.*com/
http://dmvmoneymakers.*com/
http://dmvrealestatesecrets.*com/
http://freeafterschoolcd.*com/
http://freebjjgift.*com/
http://getpaidbylloyd.*com/
http://informarketingblueprint.*com/
http://jiujitsunerd.*com/2013/01/
http://jttorresgameplan.*com/
http://lloydirvinblueprint.*com/st.aspx
http://lloydirvinexpose.*com/
http://lloydirvinexposed.*com/
http://lloydirvinlive.*com/blog/
http://lloydirvinscandal.*com/
http://lloydirvinwrestling.*com/?page_id=2
http://marylandbjjinstruction.*com/fundamental-techniques-of-brazilian-ju-jitsu/
http://marylandrealestatesecrets.*com/
http://medalchasers.c*om/
http://mixedmartialartsmillionaires.*com/
http://mixedmartialartsmillionaires.*com/vip/
http://mmainternetmarketingsecrets.*com/register/
http://myfreeinternetdvd.*com/
http://myinternetmarketingsecretsblog.*com/about-lloyd-irvin/
http://mymmablueprintevent.*com/faq.html
http://mymmablueprinthomestudycourse.*com/marcos-avellan/
http://mymmablueprinthomestudycourse.*com/thankyou871/
http://mysuperwomanbody.*com/#
http://pgmarylandbrazilianjiujitsu.*com/#
http://teamlloydirvinkids.*com/148/maryland-kids-judo-throws-exposed/
http://teamlloydirvinrapeexposed.*com/\
http://tellmemorelloyd.*com/
http://thebjjkumite.*com/
http://themmarevolutionblog.*com/about-lloyd-irvin/
http://themmarevolutionblog.*com/about-lloyd-irvin/
http://therealestateinvestmentqueen.*com/bangladeshi-model-mim-scandal
http://therealplayerlifestyle.*com/
http://webinarmeetingroom.*com/1868/p0zdophma3/webinar-register.php?expiration=default&landingpage=default&trackingID1=XXXXXXXX&trackingID2=YYYYYYYYY
http://worldclasstrainingsecrets.*com/
http://www.dcmetroboxing.*com/about.html
http://www.maryland-bjj.*com/#
http://www.princegeorgesbjj.*com/?page_id=3’
http://www.princegeorgesmma.*com/?page_id=4
http://www.teamlloydirvinusa.*com/blog/2467/crazy-88-conquest-burlington-brawl-10-results/
http://www.thegrapplingblueprint.*com/index.php
http://www.therealestateinvestmentqueen.*com/freecd_more.htm

Note that it's not illegal to have a bazillion URLs.  But it just confirms everything we've seen already from Master Lloyd... he's determined to dig in his heels and retain any fingernail-hold he can in the BJJ community (not to mention real estate and his wife Vicki Irvin's weight loss and superwoman lifestyle adventures, and Nyjah Easton's weight loss boot camp.)  To all you people who have asked me why I'm pushing this so hard, why can't I let it go... THIS is why.  Because he's not going away and if we don't protect ourselves and our future teammates/colleagues, who will?

Are you comfortable trusting Lloyd Irvin with your sisters, friends, wives, kids?

Is he what you want to be a representative of Brazilian jiu jitsu to the Maryland community?

Does it make sense for Lloyd Irvin to teach rape prevention or self defense?

Read the truth at www.LloydIrvinRapeTruth.com.

Wednesday, April 10, 2013

Lloyd Irvin rape prevention programs have nothing on his SEO gaming programs....

Lloyd Irvin has successfully been gaming the SEO (search engine optimization) system on google for a long time now.

We all know about his flagrant purchase of  "Lloyd Irvin Rape" right after the NYE gang rape (and his subsequent apology) ... hopefully everyone knows it was clearly a false apology.  If there's any doubt in your mind, consider this:

Master Lloyd Irvin also registered the following domain names (I'm putting a * in to prevent it from boosting his page rankings..)

irvinlloydrape.*com
irvinlloydrapeexposed.*com
lloydirvinrape.*org
lloydirvinrape.*net
lloydirvinrape.*us
lloydirvinrape.*me
lloydirvinrape.*info
lloydirvinrapedefense.*com
lloyd-irvin-rape-self-defense-class.*com
lloydirvinrapeprevention.*com
lloydirvinrapepreventiontraining.*com
lloydirvinrapeselfdefenseclass.*com
lloydirvinraperesistance.*com
lloyd-irvin-rape-prevention-event.*com
lloydirvinrapepreventioninstruction.*com
lloydirvinrapeselfdefenseseminar.*com
lloydirvinrapeselfdefenseevent.*com
teamlloydirvinrape.*com
lloydirvinrapepreventionevent.*com
lloydirvinrapestatement.*com
lloydirvinrapeselfdefensetraining.*com

If you want to verify this for yourself, go to GoDaddy.com and type in the domain name you want to check (i.e. teamlloydirvinrape.*com or whatever) and it will tell you it's already registered.  It will offer you some similar variations.  To the right will be a tiny link called "WHOIS"-- click on it and you'll see...

http://who.godaddy.com/whois.aspx?domain=teamlloydirvinrape.com&prog_id=GoDaddy which shows it was registered anonymously on February 8 2013 and updated March 10 2013 by
TIERRANET INC. D/B/A DOMAINDISCOVER

teamlloydirvinrape.com
c/o Whois Privacy Service
PO BOX 501610
San Diego, CA 92150-1610

Or check his more egregious bullshit:  BaseballBatSpeed.*com and TennisStrengthTraining.*com are linking to him over and over on terms like "brazilian gracie jiu jitsu", etc.   and http://bestcashloansonline.com/links.*htm linked to Lloyd as "brazilian gracie jiu jitsu maryland"-- so does forearmstrength.*com  and baseballwriststrength.*com.

Master Lloyd is not interested in promoting women's rape defense or self defense programs.  Team Lloyd Irvin is not trying to teach seminars on rape prevention.  Team Lloyd Irvin is a byword for rape culture at this point, in the Brazilian jiu jitsu community anyways.  Lloyd Irvin is trying to bury that reality with SEO gaming.  In the Prince George County area, in the Camp Springs Maryland area, women looking to take self-defense classes aren't necessarily going to do a search on "Lloyd Irvin rape."  They might do searches on "rape prevention classes" or "self defense instruction" and then they'll find HIS sites first.

Matt Stroud wrote about Lloyd Irvin and his tricksy internet games in a publication focusing on internet marketing and SEO work:


http://mobile.theverge.com/2013/4/9/4204908/martial-arts-champ-responds-to-rape-allegations-with-internet-marketing-trickery

Further indication of his big-picture scheme to game Google: Lloyd Irvin is begging for link exchanges on his site.

http://www.lloydirvin.com/linkstous.html

This is against google policy, under google's link abuse rules:
see http://support.google.com/webmasters/bin/answer.py?hl=en&answer=66356 for more info.

Please help out and make a request to have the page removed via this tool:
https://www.google.com/webmasters/tools/removals?hl=en

Someone who wanted to investigate this process and other ways to have a bad site site removed could do so via the following links:

http://support.google.com/webmasters/bin/answer.py?hl=en&answer=1663688
https://support.google.com/websearch/answer/1370?hl=en
http://support.google.com/webmasters/bin/answer.py?hl=en&answer=35265

One concern is that, because I've posted this information, Lloyd Irvin will remove the page and won't get punished by Google.

It also appears Master Lloyd Irvin is using thoughts.com to game Google.  I suggest you folks do the same. I was told that Lloyd's single post on that site is already in the top 10 for the search "lloyd irvin rape" however I haven't been able to duplicate that result (but I'm totally new to thoughts.com so I could be searching incorrectly.  Looking forward to feedback from y'all.)

Final thought-- please repost, tweet, link on facebook, blog about, and share in whatever other ways the following site:
www.LloydIrvinRapeTruth.com

Thanks!

Tuesday, April 09, 2013

To anonymous....

To the charming, hardly literate buffoon who couldn't muster the sack to sign their own name to their comments:

Yes, I deleted your comments without publishing them.  Why?  Because my blog is not the time or place to "debate" what's on the videos and audio of the NYE gang rape.  If your brother/son/whatever he is doesn't take the plea, then the content of those videos will become public record.  It's not my place to provide another forum where you can yammer your rape apologies and slander the survivor.

YOU, sir, are the joke.  Thanks for inviting me to laugh at you.  If you're in attendance at the trial, which I hope to be, please, please come introduce yourself.  I won't even ask your name-- you just come up and say you're anonymous.  Because I think you're a piece of shit nutlicking coward and I bet you won't look me in the eye even with the protection of anonymity.

You petty imbecile.

What do you think about overly-worn belts?

My belt is looking really, really worn.  I've had it since January 2009 I think, and for a long stretch you'll remember I was training 28-29 days a month, often 2-3 times a day on weekdays.  I haven't washed it too often, maybe 5-6 times over the years, but the blue has faded to early morning-blue-grey, and the cover fabric has nearly all worn off (and the white inner contents are fraying into strings that dangle.)  And now that we're in the new facility, with morning and noon classes being added, I expect I'll get back into two- and three-a-days soon enough.

Obviously I couldn't compete in this belt.  I meant to take a picture but left my belt in the car so I'll add it later.

So, I'm thinking about buying a new belt.  Here's why:

1.  A good friend told me he's on his third brown belt, and he feels it's disrespectful to the belt to let it get too tattered.  (I've passed that stage, for sure.)

2.  Hate how a new belt won't stay tied, so I might as well get a new one and break it in a bit so I have a belt for competition.

3.  It makes me look like I should be promoted soon.  However, I feel the quality of my jiu jitsu belies such a perspective.  Plus, there isn't a single bluebelt at my academy I would feel comfortable being promoted ahead of.  As such, I'm happily going to be a blue belt for another two years or so.

What do you think?

And-- who makes a nice belt that doesn't start out all thick and stiff, but is pliable enough to stay tied from the start, and is a nice blue color?  (I had an Atama first, and the color was a little pale.)